Cells were grown in the standard Sauton medium or liquid NB (nutrient broth) medium, as well as in the modified Hartman-de-Bont medium (Shleeva et al., 2004) or modified SR-1 medium (Anuchin et al., 2009) as described below. In standard CFU assays, aliquots of decimally diluted cell suspensions were plated on solid NB medium. The Δhlp strain and recombinant strains (Table 1) were maintained on the NB medium with 10 μg mL−1 kanamycin and grown under the same conditions as the Wt strain. The hlp gene was amplified by PCR using the forward primer 5′-GTGGATCCTGGAAATCAGTGGTCACAG-3′

and the reverse primer 5′-ATCTGCAGCCTCCCGACGAGAAGTAACG-3′ (BamHI and PstI restriction GSK3 inhibitor sites are in bold). The purified PCR product was ligated into the pGEM-T vector (Promega), resulting in pGEM-hlp, which was introduced into E. coli strain DH5α. Transformed clones were selected and examined by PCR. Thereafter, pGEM-hlp and pMind were digested with restriction enzymes BamHI and

PstI and the hlp fragment was ligated into the pMind vector. The ligated product pMind-hlp was introduced into E. coli strain DH5α, and the sequence of the cloned gene was confirmed. All vectors were introduced into E. coli by electroporation according to the BioRad this website protocol; to incorporate the vectors in M. smegmatis cells, we used the procedure as described elsewhere (Parish & Stoker, 1998). A truncated form of Micrococcus luteus Rpf, named RpfSm, served as an additive in resuscitation medium. RpfSm contained the conserved Rpf domain followed by 20-aa fragment of variable domain: ATVDTWDRLAECESNGTWDINTGNGFYGGVQFTLSSWQAVGGEGYPHQASKAEQIKRAEILQDLQGWGAWPLCSQKLGLTQADADAGDVDATE. The truncated gene was amplified by PCR from the pET-19b-Rpf (Mukamolova et

al., 1998), using the T7 promoter primer: GCGAAATTAATACGACTCACTAT and the reverse primer: CGACGGATCCTCACTCGGTGGCGTCACGT (the BamH1 restriction site is marked in bold). The purified PCR product was digested with XbaI and BamH1, purified and ligated into pET19b vector, which was introduced in E. coli DH5α. The construct, containing the truncated rpf gene (rpfSm), was sequenced and used to transform E. coli HSM174 (DE3). RpfSm was purified from 350 mL cultures of E. coli producer strain grown at 37 °C in the rich medium Cyclin-dependent kinase 3 (HiMedia) with ampicillin (100 μg mL−1) to OD600 nm 0.65–0.8. After induction with 1 mM IPTG, growth was continued for 2 h at room temperature. Cells were harvested by centrifugation at 3000 g for 15 min and frozen in binding buffer (BB) (20 mM Tris-HCl, pH 8.0; 0.5 M NaCl; 5 mM imidazole). Thawed cell suspensions in 10 mM MgSO4 were treated with RNAse and DNAse at concentrations 10 μg mL−1 each and then with 8 M urea. After sonication, the crude extract was centrifuged at 6000 g for 30 min to remove cell debris, and supernatant was applied onto a 2-mL Ni2+-chelation column (Sigma) equilibrated with BB.